Recombinant Human GRIA2 protein, His-tagged

Cat.No. : GRIA2-1352H
Product Overview : Recombinant Human GRIA2 protein(NP_000817.5)(Asn413~Lys527) was expressed in E. coli with a N-terminal Tag, His Tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Asn413~Lys527
Description : Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels. These channels are assembled from 4 related subunits, GRIA1-4. The subunit encoded by this gene (GRIA2) is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to render the channel impermeable to Ca(2+). Human and animal studies suggest that pre-mRNA editing is essential for brain function, and defective GRIA2 RNA editing at the Q/R site may be relevant to amyotrophic lateral sclerosis (ALS) etiology. Alternative splicing, resulting in transcript variants encoding different isoforms, (including the flip and flop isoforms that vary in their signal transduction properties), has been noted for this gene.
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 17KDa(Analysis of differences refer to the manual).
AA Sequence : NKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKK
Endotoxin : <1.0 EU per μg protein as determined by the LAL method.
Purity : >95%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
(May be suitable for use in other assays to be determined by the end user.)
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name GRIA2
Official Symbol GRIA2
Synonyms GLUR2; GLURB; HBGR2; GluR-K2; AMPA-selective glutamate receptor 2
Gene ID 2891
mRNA Refseq NM_000826.6
Protein Refseq NP_000817.5
MIM 138247
UniProt ID P42262

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIA2 Products

Required fields are marked with *

My Review for All GRIA2 Products

Required fields are marked with *

0
cart-icon