Recombinant Human GSPT1 protein, GST-tagged
| Cat.No. : | GSPT1-909H |
| Product Overview : | Recombinant Human GSPT1(390 a.a. - 499 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 390-499 a.a. |
| Description : | GSPT1 played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | GRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTIC LETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | GSPT1 G1 to S phase transition 1 [ Homo sapiens ] |
| Official Symbol | GSPT1 |
| Synonyms | GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067; |
| Gene ID | 2935 |
| mRNA Refseq | NM_002094 |
| Protein Refseq | NP_002085 |
| MIM | 139259 |
| UniProt ID | P15170 |
| Chromosome Location | 16p13.1 |
| Pathway | mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem; |
| Function | GTP binding; GTPase activity; nucleotide binding; protein binding; translation release factor activity; |
| ◆ Recombinant Proteins | ||
| GSPT1-6789H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
| GSPT1-3873C | Recombinant Chicken GSPT1 | +Inquiry |
| GSPT1-12HFL | Recombinant Full Length Human GSPT1 Protein, Avi tagged, Biotin Labeled | +Inquiry |
| GSPT1-941H | Recombinant Human GSPT1 Protein, His-tagged | +Inquiry |
| GSPT1-2473H | Recombinant Human GSPT1 Protein (1-499 aa), His-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSPT1 Products
Required fields are marked with *
My Review for All GSPT1 Products
Required fields are marked with *
