Recombinant Human GSPT1 protein, GST-tagged

Cat.No. : GSPT1-909H
Product Overview : Recombinant Human GSPT1(390 a.a. - 499 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 390-499 a.a.
Description : GSPT1 played an important role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : GRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTIC LETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name GSPT1 G1 to S phase transition 1 [ Homo sapiens ]
Official Symbol GSPT1
Synonyms GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067;
Gene ID 2935
mRNA Refseq NM_002094
Protein Refseq NP_002085
MIM 139259
UniProt ID P15170
Chromosome Location 16p13.1
Pathway mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem;
Function GTP binding; GTPase activity; nucleotide binding; protein binding; translation release factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSPT1 Products

Required fields are marked with *

My Review for All GSPT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon