Recombinant Human GSTM1 Protein, GST-tagged
| Cat.No. : | GSTM1-4415H |
| Product Overview : | Human GSTM1 full-length ORF ( AAH24005, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq |
| Molecular Mass : | 45.65 kDa |
| AA Sequence : | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GSTM1 glutathione S-transferase mu 1 [ Homo sapiens ] |
| Official Symbol | GSTM1 |
| Synonyms | GSTM1; glutathione S-transferase mu 1; glutathione S transferase M1 , GST1; glutathione S-transferase Mu 1; H B; MU; HB subunit 4; GST class-mu 1; GST HB subunit 4; glutathione S-transferase M1; glutathione S-aryltransferase; glutathione S-alkyltransferase; glutathione S-aralkyltransferase; S-(hydroxyalkyl)glutathione lyase; H-B; GST1; GTH4; GTM1; MU-1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; MGC26563; |
| Gene ID | 2944 |
| mRNA Refseq | NM_000561 |
| Protein Refseq | NP_000552 |
| MIM | 138350 |
| UniProt ID | P09488 |
| ◆ Recombinant Proteins | ||
| Gstm1-2507M | Active Recombinant Mouse Glutathione S-Transferase, Mu 1, His-tagged | +Inquiry |
| GSTM1-105H | Active Recombinant Human GSTM1 Protein | +Inquiry |
| GSTM1-907H | Recombinant Human GSTM1 Protein, His-tagged | +Inquiry |
| Gstm1-7220M | Recombinant Mouse Gstm1 Protein | +Inquiry |
| GSTM1-514H | Recombinant Human glutathione S-transferase mu 1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTM1 Products
Required fields are marked with *
My Review for All GSTM1 Products
Required fields are marked with *
