Recombinant Human GSTM2 Protein, GST-tagged
| Cat.No. : | GSTM2-4418H |
| Product Overview : | Human GSTM2 partial ORF ( NP_000839, 90 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GSTM2 glutathione S-transferase mu 2 (muscle) [ Homo sapiens ] |
| Official Symbol | GSTM2 |
| Synonyms | GSTM2; glutathione S-transferase mu 2 (muscle); glutathione S transferase M2 (muscle); glutathione S-transferase Mu 2; GST4; GST, muscle; GST class-mu 2; glutathione S-transferase 4; glutathione S-transferase M1; glutathione S-aryltransferase M2; glutathione S-alkyltransferase M2; glutathione S-aralkyltransferase M2; S-(hydroxyalkyl)glutathione lyase M2; glutathione S-transferase M2 (muscle); GSTM; GTHMUS; GSTM2-2; MGC117303; |
| Gene ID | 2946 |
| mRNA Refseq | NM_000848 |
| Protein Refseq | NP_000839 |
| MIM | 138380 |
| UniProt ID | P28161 |
| ◆ Recombinant Proteins | ||
| GSTM2-794H | Recombinant Human Glutathione S-transferase Mu 2 (Muscle), His-tagged | +Inquiry |
| GSTM2-1691H | Active Recombinant Human Glutathione S-Transferase Mu 2 (Muscle), His-tagged | +Inquiry |
| GSTM2-2553H | Recombinant Human GSTM2 Protein (Met3-Lys218), N-His tagged | +Inquiry |
| GSTM2-575C | Recombinant Cynomolgus GSTM2 Protein, His-tagged | +Inquiry |
| GSTM2-321C | Recombinant Cynomolgus Monkey GSTM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTM2-5712HCL | Recombinant Human GSTM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTM2 Products
Required fields are marked with *
My Review for All GSTM2 Products
Required fields are marked with *
