Recombinant Human GSTM2 Protein, GST-tagged

Cat.No. : GSTM2-4418H
Product Overview : Human GSTM2 partial ORF ( NP_000839, 90 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSTM2 glutathione S-transferase mu 2 (muscle) [ Homo sapiens ]
Official Symbol GSTM2
Synonyms GSTM2; glutathione S-transferase mu 2 (muscle); glutathione S transferase M2 (muscle); glutathione S-transferase Mu 2; GST4; GST, muscle; GST class-mu 2; glutathione S-transferase 4; glutathione S-transferase M1; glutathione S-aryltransferase M2; glutathione S-alkyltransferase M2; glutathione S-aralkyltransferase M2; S-(hydroxyalkyl)glutathione lyase M2; glutathione S-transferase M2 (muscle); GSTM; GTHMUS; GSTM2-2; MGC117303;
Gene ID 2946
mRNA Refseq NM_000848
Protein Refseq NP_000839
MIM 138380
UniProt ID P28161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTM2 Products

Required fields are marked with *

My Review for All GSTM2 Products

Required fields are marked with *

0
cart-icon
0
compare icon