Recombinant Human GTF2A2 Protein, GST-tagged
| Cat.No. : | GTF2A2-4439H |
| Product Overview : | Human GTF2A2 full-length ORF ( AAH00287, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GTF2A2 general transcription factor IIA, 2, 12kDa [ Homo sapiens ] |
| Official Symbol | GTF2A2 |
| Synonyms | GTF2A2; general transcription factor IIA, 2, 12kDa; general transcription factor IIA, 2 (12kD subunit); transcription initiation factor IIA subunit 2; HsT18745; TFIIA; TFIIAS; TFIIA-12; TFIIA-gamma; TFIIA p12 subunit; general transcription factor IIA subunit 2; transcription initiation factor IIA gamma chain; TF2A2; |
| Gene ID | 2958 |
| mRNA Refseq | NM_004492 |
| Protein Refseq | NP_004483 |
| MIM | 600519 |
| UniProt ID | P52657 |
| ◆ Recombinant Proteins | ||
| GTF2A2-3004H | Recombinant Human GTF2A2 protein, GST-tagged | +Inquiry |
| GTF2A2-27775TH | Recombinant Human GTF2A2 | +Inquiry |
| GTF2A2-2394R | Recombinant Rat GTF2A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GTF2A2-2785Z | Recombinant Zebrafish GTF2A2 | +Inquiry |
| GTF2A2-419H | Recombinant Human GTF2A2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GTF2A2-5704HCL | Recombinant Human GTF2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2A2 Products
Required fields are marked with *
My Review for All GTF2A2 Products
Required fields are marked with *
