Recombinant Human GUCA1B Protein, GST-tagged
Cat.No. : | GUCA1B-4484H |
Product Overview : | Human GUCA1B partial ORF ( NP_002089, 93 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq, Nov 2009] |
Molecular Mass : | 37.62 kDa |
AA Sequence : | KLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQDQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GUCA1B guanylate cyclase activator 1B (retina) [ Homo sapiens ] |
Official Symbol | GUCA1B |
Synonyms | GUCA1B; guanylate cyclase activator 1B (retina); guanylyl cyclase-activating protein 2; GCAP2; GCAP 2; guanylate cyclase-activating protein, photoreceptor 2; RP48; GUCA2; DKFZp686E1183; |
Gene ID | 2979 |
mRNA Refseq | NM_002098 |
Protein Refseq | NP_002089 |
MIM | 602275 |
UniProt ID | Q9UMX6 |
◆ Recombinant Proteins | ||
GUCA1B-4484H | Recombinant Human GUCA1B Protein, GST-tagged | +Inquiry |
GUCA1B-9375Z | Recombinant Zebrafish GUCA1B | +Inquiry |
GUCA1B-4007M | Recombinant Mouse GUCA1B Protein, His (Fc)-Avi-tagged | +Inquiry |
GUCA1B-1787C | Recombinant Chicken GUCA1B | +Inquiry |
GUCA1B-808H | Recombinant Human GUCA1B Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA1B Products
Required fields are marked with *
My Review for All GUCA1B Products
Required fields are marked with *
0
Inquiry Basket