Recombinant Human GUCA1B Protein, GST-tagged

Cat.No. : GUCA1B-4484H
Product Overview : Human GUCA1B partial ORF ( NP_002089, 93 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq, Nov 2009]
Molecular Mass : 37.62 kDa
AA Sequence : KLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQDQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUCA1B guanylate cyclase activator 1B (retina) [ Homo sapiens ]
Official Symbol GUCA1B
Synonyms GUCA1B; guanylate cyclase activator 1B (retina); guanylyl cyclase-activating protein 2; GCAP2; GCAP 2; guanylate cyclase-activating protein, photoreceptor 2; RP48; GUCA2; DKFZp686E1183;
Gene ID 2979
mRNA Refseq NM_002098
Protein Refseq NP_002089
MIM 602275
UniProt ID Q9UMX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCA1B Products

Required fields are marked with *

My Review for All GUCA1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon