Recombinant Human HEATR3 protein, GST-tagged
Cat.No. : | HEATR3-301489H |
Product Overview : | Recombinant Human HEATR3 (501-680 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser501-Ser680 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SQPDFAKHVDFLEAISSALRALLQTMASKNISQCMTPDQLMTLCKAGIHSSNVGVRVNVVSILGITGSVLAKEDGTLETLKNIGCFLLEVTTKDPSLVVAGEALDALFDVFADGKEAERASIQIKLLSALKEFQPVFKMKIRKEGRGNYSTDQLCVLDNVKMNLRRFIAYQETVEKRLTS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | HEATR3 HEAT repeat containing 3 [ Homo sapiens ] |
Official Symbol | HEATR3 |
Gene ID | 55027 |
mRNA Refseq | NM_182922.2 |
Protein Refseq | NP_891552.1 |
UniProt ID | Q7Z4Q2 |
◆ Recombinant Proteins | ||
HEATR3-301489H | Recombinant Human HEATR3 protein, GST-tagged | +Inquiry |
HEATR3-3029H | Recombinant Human HEATR3 protein, His-tagged | +Inquiry |
HEATR3-2282C | Recombinant Chicken HEATR3 | +Inquiry |
HEATR3-4670H | Recombinant Human HEATR3 Protein, GST-tagged | +Inquiry |
HEATR3-7549M | Recombinant Mouse HEATR3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEATR3 Products
Required fields are marked with *
My Review for All HEATR3 Products
Required fields are marked with *