Recombinant Human HERPUD2 protein, His-tagged

Cat.No. : HERPUD2-128H
Product Overview : Recombinant Human HERPUD2 protein(NP_071768)(1-200 aa), fused to His tag, was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-200 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAH
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name HERPUD2 HERPUD family member 2 [ Homo sapiens ]
Official Symbol HERPUD2
Synonyms HERPUD2; HERPUD family member 2; homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein; FLJ22313; homocysteine inducible; endoplasmic reticulum stress inducible; ubiquitin like domain member 2; homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2; FLJ31032;
Gene ID 64224
mRNA Refseq NM_022373
Protein Refseq NP_071768
UniProt ID Q9BSE4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HERPUD2 Products

Required fields are marked with *

My Review for All HERPUD2 Products

Required fields are marked with *

0
cart-icon