Recombinant Human HNRNPA2B1 protein, His&Myc-tagged
| Cat.No. : | HNRNPA2B1-786H |
| Product Overview : | Recombinant Human HNRNPA2B1 protein(P22626)(1-353aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-353aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.9 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY |
| Gene Name | HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Homo sapiens ] |
| Official Symbol | HNRNPA2B1 |
| Synonyms | HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; HNRPA2B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2 / hnRNP B1; nuclear ribonucleoprotein particle A2 protein; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; FLJ22720; DKFZp779B0244; |
| Gene ID | 3181 |
| mRNA Refseq | NM_002137 |
| Protein Refseq | NP_002128 |
| MIM | 600124 |
| UniProt ID | P22626 |
| ◆ Recombinant Proteins | ||
| HNRNPA2B1-3045H | Recombinant Human HNRNPA2B1 protein, His-tagged | +Inquiry |
| HNRNPA2B1-4258M | Recombinant Mouse HNRNPA2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNRNPA2B1-7757M | Recombinant Mouse HNRNPA2B1 Protein | +Inquiry |
| HNRNPA2B1-965H | Recombinant Human HNRNPA2B1 protein, hFc-tagged | +Inquiry |
| HNRNPA2B1-37H | Recombinant Human HNRNPA2B1, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPA2B1-334HCL | Recombinant Human HNRNPA2B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA2B1 Products
Required fields are marked with *
My Review for All HNRNPA2B1 Products
Required fields are marked with *
