Recombinant Human HNRNPK protein(11-100 aa), C-His-tagged

Cat.No. : HNRNPK-2801H
Product Overview : Recombinant Human HNRNPK protein(P61978)(11-100 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-100 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
Gene Name HNRNPK heterogeneous nuclear ribonucleoprotein K [ Homo sapiens ]
Official Symbol HNRNPK
Synonyms HNRNPK; heterogeneous nuclear ribonucleoprotein K; HNRPK; CSBP; transformation upregulated nuclear protein; TUNP; dC-stretch binding protein; FLJ41122;
Gene ID 3190
mRNA Refseq NM_002140
Protein Refseq NP_002131
MIM 600712
UniProt ID P61978

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPK Products

Required fields are marked with *

My Review for All HNRNPK Products

Required fields are marked with *

0
cart-icon
0
compare icon