Recombinant Human HNRNPK protein(11-100 aa), C-His-tagged
Cat.No. : | HNRNPK-2801H |
Product Overview : | Recombinant Human HNRNPK protein(P61978)(11-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI |
Gene Name | HNRNPK heterogeneous nuclear ribonucleoprotein K [ Homo sapiens ] |
Official Symbol | HNRNPK |
Synonyms | HNRNPK; heterogeneous nuclear ribonucleoprotein K; HNRPK; CSBP; transformation upregulated nuclear protein; TUNP; dC-stretch binding protein; FLJ41122; |
Gene ID | 3190 |
mRNA Refseq | NM_002140 |
Protein Refseq | NP_002131 |
MIM | 600712 |
UniProt ID | P61978 |
◆ Recombinant Proteins | ||
HNRNPK-1190H | Recombinant Human HNRNPK Protein (3-459 aa), GST-tagged | +Inquiry |
HNRNPK-1089H | Recombinant Human HNRNPK Protein, His (Fc)-Avi-tagged | +Inquiry |
Hnrnpk-1151M | Recombinant Mouse Hnrnpk Protein, MYC/DDK-tagged | +Inquiry |
HNRNPK-2540R | Recombinant Rat HNRNPK Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPK-338C | Recombinant Cynomolgus Monkey HNRNPK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPK-5442HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
HNRNPK-5443HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPK Products
Required fields are marked with *
My Review for All HNRNPK Products
Required fields are marked with *