Recombinant Human HOXA10 Protein, GST-tagged
Cat.No. : | HOXA10-4939H |
Product Overview : | Human HOXA10 full-length ORF (ABM86018.1, 1 a.a. - 393 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq |
Molecular Mass : | 69.63 kDa |
AA Sequence : | MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXA10 homeobox A10 [ Homo sapiens ] |
Official Symbol | HOXA10 |
Synonyms | HOXA10; homeobox A10; homeo box A10 , HOX1, HOX1H; homeobox protein Hox-A10; homeo box A10; homeobox protein 1H; homeobox protein HOXA10; homeobox protein Hox-1H; homeobox protein Hox-1.8; PL; HOX1; HOX1H; HOX1.8; MGC12859; |
Gene ID | 3206 |
mRNA Refseq | NM_018951 |
Protein Refseq | NP_061824 |
MIM | 142957 |
UniProt ID | P31260 |
◆ Recombinant Proteins | ||
Hoxa10-1152M | Recombinant Mouse Hoxa10 Protein, MYC/DDK-tagged | +Inquiry |
HOXA10-4275M | Recombinant Mouse HOXA10 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA10-3707HF | Recombinant Full Length Human HOXA10 Protein, GST-tagged | +Inquiry |
HOXA10-4939H | Recombinant Human HOXA10 Protein, GST-tagged | +Inquiry |
HOXA10-7785M | Recombinant Mouse HOXA10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA10-5429HCL | Recombinant Human HOXA10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXA10 Products
Required fields are marked with *
My Review for All HOXA10 Products
Required fields are marked with *