Recombinant Human ITIH5 Protein (35-161 aa), His-SUMO-tagged
Cat.No. : | ITIH5-1051H |
Product Overview : | Recombinant Human ITIH5 Protein (35-161 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 35-161 aa |
Description : | May act as a tumor suppressor. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 30.6 kDa |
AA Sequence : | VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ITIH5 inter-alpha-trypsin inhibitor heavy chain family, member 5 [ Homo sapiens ] |
Official Symbol | ITIH5 |
Synonyms | ITIH5; MGC10848; ITI heavy chain H5; ITI-HC5; PP14776; DKFZp686F0145; |
Gene ID | 80760 |
mRNA Refseq | NM_001001851 |
Protein Refseq | NP_001001851 |
MIM | 609783 |
UniProt ID | Q86UX2 |
◆ Recombinant Proteins | ||
ITIH5-955H | Recombinant Human ITIH5 | +Inquiry |
ITIH5-992HFL | Recombinant Full Length Human ITIH5 Protein, C-Flag-tagged | +Inquiry |
ITIH5-8378M | Recombinant Mouse Itih5 protein, His-tagged | +Inquiry |
ITIH5-2593H | Recombinant Human ITIH5 Protein (Gln251-Asn508), His tagged | +Inquiry |
ITIH5-1222H | Recombinant Human ITIH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITIH5 Products
Required fields are marked with *
My Review for All ITIH5 Products
Required fields are marked with *