Recombinant Human ITIH5 Protein (35-161 aa), His-SUMO-tagged

• Cat.No.: ITIH5-1051H
• Product Overview: Recombinant Human ITIH5 Protein (35-161 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 35-161 aa
• Description: May act as a tumor suppressor.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 30.6 kDa
• AA Sequence: VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ITIH5 inter-alpha-trypsin inhibitor heavy chain family, member 5 [ Homo sapiens ]
• Official Symbol: ITIH5
• Synonyms: ITIH5; MGC10848; ITI heavy chain H5; ITI-HC5; PP14776; DKFZp686F0145
• Gene ID: 80760
• mRNA Refseq: NM_001001851
• Protein Refseq: NP_001001851
• MIM: 609783
• UniProt ID: Q86UX2