Recombinant Human IWS1 protein, His-tagged
Cat.No. : | IWS1-0395H |
Product Overview : | Recombinant Human IWS1 protein(523-819 aa), fused to His tag, was expressed in E. coli. |
Availability | September 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 523-819 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQATSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IWS1 IWS1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | IWS1 |
Synonyms | IWS1; IWS1 homolog (S. cerevisiae); protein IWS1 homolog; DKFZp761G0123; FLJ10006; FLJ14655; FLJ32319; IWS1-like protein; interacts with Spt6; MGC126375; MGC126376; |
Gene ID | 55677 |
mRNA Refseq | NM_017969 |
Protein Refseq | NP_060439 |
UniProt ID | Q96ST2 |
◆ Recombinant Proteins | ||
IWS1-4939H | Recombinant Human IWS1 Protein, GST-tagged | +Inquiry |
IWS1-3131R | Recombinant Rat IWS1 Protein | +Inquiry |
IWS1-8400M | Recombinant Mouse IWS1 Protein | +Inquiry |
IWS1-4662M | Recombinant Mouse IWS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IWS1-5852HF | Recombinant Full Length Human IWS1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IWS1 Products
Required fields are marked with *
My Review for All IWS1 Products
Required fields are marked with *