Recombinant Human JOSD2 protein, His-tagged
Cat.No. : | JOSD2-7865H |
Product Overview : | Recombinant Human JOSD2 protein(80-188 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 80-188 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | LGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | JOSD2 Josephin domain containing 2 [ Homo sapiens ] |
Official Symbol | JOSD2 |
Synonyms | JOSD2; Josephin domain containing 2; Josephin-2; SBBI54; josephin domain-containing protein 2; FLJ29018; |
Gene ID | 126119 |
mRNA Refseq | NM_138334 |
Protein Refseq | NP_612207 |
UniProt ID | Q8TAC2 |
◆ Recombinant Proteins | ||
JOSD2-0301H | Recombinant Human JOSD2 Protein (S2-D188), Tag Free | +Inquiry |
Josd2-3635M | Recombinant Mouse Josd2 Protein, Myc/DDK-tagged | +Inquiry |
JOSD2-8429M | Recombinant Mouse JOSD2 Protein | +Inquiry |
JOSD2-0302H | Recombinant Human JOSD2 Protein (S2-D188), His tagged | +Inquiry |
JOSD2-4685M | Recombinant Mouse JOSD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JOSD2-5098HCL | Recombinant Human JOSD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JOSD2 Products
Required fields are marked with *
My Review for All JOSD2 Products
Required fields are marked with *