Recombinant Human JPH1 protein, GST-tagged

Cat.No. : JPH1-785H
Product Overview : Recombinant Human JPH1 protein(NP_065698)(464-639 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 464-639 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : RSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name JPH1 junctophilin 1 [ Homo sapiens ]
Official Symbol JPH1
Synonyms JPH1; junctophilin 1; junctophilin-1; JP 1; mitsugumin72; junctophilin type1; junctophilin type 1; JP1; JP-1; DKFZp762L0313;
Gene ID 56704
mRNA Refseq NM_020647
Protein Refseq NP_065698
MIM 605266
UniProt ID Q9HDC5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JPH1 Products

Required fields are marked with *

My Review for All JPH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon