Recombinant Human JPH1 protein, GST-tagged
Cat.No. : | JPH1-785H |
Product Overview : | Recombinant Human JPH1 protein(NP_065698)(464-639 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 464-639 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPSKSVTKPVAKESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | JPH1 junctophilin 1 [ Homo sapiens ] |
Official Symbol | JPH1 |
Synonyms | JPH1; junctophilin 1; junctophilin-1; JP 1; mitsugumin72; junctophilin type1; junctophilin type 1; JP1; JP-1; DKFZp762L0313; |
Gene ID | 56704 |
mRNA Refseq | NM_020647 |
Protein Refseq | NP_065698 |
MIM | 605266 |
UniProt ID | Q9HDC5 |
◆ Recombinant Proteins | ||
JPH1-7842H | Recombinant Human JPH1 protein, His-tagged | +Inquiry |
JPH1-8430M | Recombinant Mouse JPH1 Protein | +Inquiry |
Jph1-1708M | Recombinant Mouse Jph1 Protein, His-tagged | +Inquiry |
JPH1-785H | Recombinant Human JPH1 protein, GST-tagged | +Inquiry |
JPH1-4686M | Recombinant Mouse JPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JPH1 Products
Required fields are marked with *
My Review for All JPH1 Products
Required fields are marked with *
0
Inquiry Basket