Recombinant Human KCNJ4 protein(231-310 aa), C-His-tagged
Cat.No. : | KCNJ4-2769H |
Product Overview : | Recombinant Human KCNJ4 protein(P48050)(231-310 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 231-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLAS |
Gene Name | KCNJ4 potassium inwardly-rectifying channel, subfamily J, member 4 [ Homo sapiens ] |
Official Symbol | KCNJ4 |
Synonyms | KCNJ4; potassium inwardly-rectifying channel, subfamily J, member 4; inward rectifier potassium channel 4; HIR; hIRK2; HRK1; IRK3; Kir2.3; inward rectifier K+ channel Kir2.3; inward rectifier K(+) channel Kir2.3; hippocampal inward rectifier potassium channel; potassium channel, inwardly rectifying subfamily J member 4; HIRK2; IRK-3; MGC142066; MGC142068; |
Gene ID | 3761 |
mRNA Refseq | NM_004981 |
Protein Refseq | NP_004972 |
MIM | 600504 |
UniProt ID | P48050 |
◆ Cell & Tissue Lysates | ||
KCNJ4-5045HCL | Recombinant Human KCNJ4 293 Cell Lysate | +Inquiry |
KCNJ4-5046HCL | Recombinant Human KCNJ4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ4 Products
Required fields are marked with *
My Review for All KCNJ4 Products
Required fields are marked with *