Recombinant Human KCNJ4 protein(231-310 aa), C-His-tagged

Cat.No. : KCNJ4-2769H
Product Overview : Recombinant Human KCNJ4 protein(P48050)(231-310 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 231-310 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLAS
Gene Name KCNJ4 potassium inwardly-rectifying channel, subfamily J, member 4 [ Homo sapiens ]
Official Symbol KCNJ4
Synonyms KCNJ4; potassium inwardly-rectifying channel, subfamily J, member 4; inward rectifier potassium channel 4; HIR; hIRK2; HRK1; IRK3; Kir2.3; inward rectifier K+ channel Kir2.3; inward rectifier K(+) channel Kir2.3; hippocampal inward rectifier potassium channel; potassium channel, inwardly rectifying subfamily J member 4; HIRK2; IRK-3; MGC142066; MGC142068;
Gene ID 3761
mRNA Refseq NM_004981
Protein Refseq NP_004972
MIM 600504
UniProt ID P48050

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNJ4 Products

Required fields are marked with *

My Review for All KCNJ4 Products

Required fields are marked with *

0
cart-icon