Recombinant Human KDM2A protein, His-tagged
| Cat.No. : | KDM2A-3101H |
| Product Overview : | Recombinant Human KDM2A protein(374-558 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 374-558 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | DEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAAS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | KDM2A |
| Synonyms | KDM2A; lysine (K)-specific demethylase 2A; F box and leucine rich repeat protein 11 , FBXL11; lysine-specific demethylase 2A; CXXC8; DKFZP434M1735; F box protein FBL11; FBL7; FBL11; FLJ00115; JHDM1A; jumonji C domain containing histone demethylase 1A; KIAA1004; LILINA; F-box/LRR-repeat protein 11; CXXC-type zinc finger protein 8; [Histone-H3]-lysine-36 demethylase 1A; F-box and leucine-rich repeat protein 11; jumonji C domain-containing histone demethylase 1A; jmjC domain-containing histone demethylation protein 1A; FBXL11; FLJ46431; DKFZp434M1735; |
| Gene ID | 22992 |
| mRNA Refseq | NM_001256405 |
| Protein Refseq | NP_001243334 |
| MIM | 605657 |
| UniProt ID | Q9Y2K7 |
| ◆ Recombinant Proteins | ||
| KDM2A-4920HF | Recombinant Full Length Human KDM2A Protein, GST-tagged | +Inquiry |
| KDM2A-213H | Recombinant Human KDM2A, GST-tagged | +Inquiry |
| KDM2A-0527H | Recombinant Human KDM2A Protein (R567-S681), Tag Free | +Inquiry |
| KDM2A7257H | Recombinant Human KDM2A (1-383) Protein | +Inquiry |
| KDM2A-3885H | Recombinant Human KDM2A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM2A Products
Required fields are marked with *
My Review for All KDM2A Products
Required fields are marked with *
