Recombinant Human KIFC1 protein, GST-tagged

Cat.No. : KIFC1-43H
Product Overview : Recombinant Human KIFC1(53 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 53-152 a.a.
Description : KIFC1 played an important role in many functions.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.41 kDa
AA Sequence : MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTV PQTQGQTTAQKVSKKTGPRCSTAIA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name KIFC1 kinesin family member C1 [ Homo sapiens ]
Official Symbol KIFC1
Synonyms KIFC1; kinesin family member C1; kinesin like 2 , KNSL2; kinesin-like protein KIFC1; HSET; kinesin-like 2; kinesin-like protein 2; kinesin-related protein HSET; KNSL2; MGC1202; MGC149736; MGC149737;
Gene ID 3833
mRNA Refseq NM_002263
Protein Refseq NP_002254
MIM 603763
UniProt ID Q9BW19
Chromosome Location 6p21.32
Pathway Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem;
Function ATP binding; microtubule motor activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KIFC1 Products

Required fields are marked with *

My Review for All KIFC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon