Recombinant Human KIFC1 protein, GST-tagged
Cat.No. : | KIFC1-43H |
Product Overview : | Recombinant Human KIFC1(53 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 53-152 a.a. |
Description : | KIFC1 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.41 kDa |
AA Sequence : | MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTV PQTQGQTTAQKVSKKTGPRCSTAIA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | KIFC1 kinesin family member C1 [ Homo sapiens ] |
Official Symbol | KIFC1 |
Synonyms | KIFC1; kinesin family member C1; kinesin like 2 , KNSL2; kinesin-like protein KIFC1; HSET; kinesin-like 2; kinesin-like protein 2; kinesin-related protein HSET; KNSL2; MGC1202; MGC149736; MGC149737; |
Gene ID | 3833 |
mRNA Refseq | NM_002263 |
Protein Refseq | NP_002254 |
MIM | 603763 |
UniProt ID | Q9BW19 |
Chromosome Location | 6p21.32 |
Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem; |
Function | ATP binding; microtubule motor activity; nucleotide binding; |
◆ Recombinant Proteins | ||
KIFC1-4824M | Recombinant Mouse KIFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KIFC1-8654M | Recombinant Mouse KIFC1 Protein | +Inquiry |
KIFC1-3660C | Recombinant Chicken KIFC1 | +Inquiry |
KIFC1-641HF | Recombinant Full Length Human KIFC1 Protein, GST-tagged | +Inquiry |
KIFC1-2916R | Recombinant Rat KIFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIFC1-363HCL | Recombinant Human KIFC1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIFC1 Products
Required fields are marked with *
My Review for All KIFC1 Products
Required fields are marked with *
0
Inquiry Basket