Recombinant Human KLHL2 protein, His-tagged
Cat.No. : | KLHL2-7453H |
Product Overview : | Recombinant Human KLHL2 protein(273-593 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 273-593 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | DYLIEAMKYHLLPTEQRILMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKRL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | KLHL2 kelch-like 2, Mayven (Drosophila) [ Homo sapiens ] |
Official Symbol | KLHL2 |
Synonyms | KLHL2; kelch-like 2, Mayven (Drosophila); kelch (Drosophila) like 2 (Mayven); kelch-like protein 2; MAV; kelch; actin-binding protein Mayven; MAYVEN; ABP-KELCH; |
Gene ID | 11275 |
mRNA Refseq | NM_001161521 |
Protein Refseq | NP_001154993 |
MIM | 605774 |
UniProt ID | O95198 |
◆ Recombinant Proteins | ||
KLHL2-1426HFL | Recombinant Full Length Human KLHL2 Protein, C-Flag-tagged | +Inquiry |
KLHL2-4854M | Recombinant Mouse KLHL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHL2-5172C | Recombinant Chicken KLHL2 | +Inquiry |
KLHL2-1162H | Recombinant Human KLHL2 protein(Met1-Pro306), GST-tagged | +Inquiry |
KLHL2-558H | Recombinant Human KLHL2, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL2-4911HCL | Recombinant Human KLHL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHL2 Products
Required fields are marked with *
My Review for All KLHL2 Products
Required fields are marked with *