Recombinant Human MGST1

Cat.No. : MGST1-30203TH
Product Overview : Recombinant full length Human Microsomal Glutathione S-transferase 1 with a N terminal proprietary tag; predicted MW: 42.79 kDa inclusive of tag. P10620, AAH05923.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 155 amino acids
Description : The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform.
Molecular Weight : 42.790kDa inclusive of tags
Tissue specificity : Highly expressed in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLT RKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDL ENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
Sequence Similarities : Belongs to the MAPEG family.
Gene Name MGST1 microsomal glutathione S-transferase 1 [ Homo sapiens ]
Official Symbol MGST1
Synonyms MGST1; microsomal glutathione S-transferase 1; GST12; MGST I;
Gene ID 4257
mRNA Refseq NM_020300
Protein Refseq NP_064696
MIM 138330
Uniprot ID P10620
Chromosome Location 12p12.3-p12.1
Pathway Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function glutathione binding; glutathione transferase activity; protein binding; protein homodimerization activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MGST1 Products

Required fields are marked with *

My Review for All MGST1 Products

Required fields are marked with *

0
cart-icon