Recombinant Human MGST1
Cat.No. : | MGST1-30203TH |
Product Overview : | Recombinant full length Human Microsomal Glutathione S-transferase 1 with a N terminal proprietary tag; predicted MW: 42.79 kDa inclusive of tag. P10620, AAH05923. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 155 amino acids |
Description : | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. |
Molecular Weight : | 42.790kDa inclusive of tags |
Tissue specificity : | Highly expressed in liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLT RKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDL ENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL |
Sequence Similarities : | Belongs to the MAPEG family. |
Gene Name | MGST1 microsomal glutathione S-transferase 1 [ Homo sapiens ] |
Official Symbol | MGST1 |
Synonyms | MGST1; microsomal glutathione S-transferase 1; GST12; MGST I; |
Gene ID | 4257 |
mRNA Refseq | NM_020300 |
Protein Refseq | NP_064696 |
MIM | 138330 |
Uniprot ID | P10620 |
Chromosome Location | 12p12.3-p12.1 |
Pathway | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; |
Function | glutathione binding; glutathione transferase activity; protein binding; protein homodimerization activity; transferase activity; |
◆ Recombinant Proteins | ||
RFL27854MF | Recombinant Full Length Mouse Microsomal Glutathione S-Transferase 1(Mgst1) Protein, His-Tagged | +Inquiry |
MGST1-305HF | Recombinant Full Length Human MGST1 Protein | +Inquiry |
MGST1-220H | Recombinant Human MGST1 | +Inquiry |
MGST1-2439H | Recombinant Human MGST1 Protein, His-tagged | +Inquiry |
MGST1-3869C | Recombinant Chicken MGST1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGST1 Products
Required fields are marked with *
My Review for All MGST1 Products
Required fields are marked with *