Recombinant Human MMAB, GST-tagged
Cat.No. : | MMAB-629H |
Product Overview : | Recombinant Human MMAB(1 a.a. - 250 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-250 a.a. |
Description : | This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGER RPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPI LELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLAR YAAMKEGNQEKIYMKNDPSAESEGL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MMAB methylmalonic aciduria (cobalamin deficiency) cblB type [ Homo sapiens ] |
Official Symbol | MMAB |
Synonyms | ATR; cob; cblB; CFAP23; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial; ATP:cob(I)alamin adenosyltransferase; ATP:corrinoid adenosyltransferase; aquocob(I)alamin vitamin B12s adenosyltransferase; cilia and flagella associated protein 23; methylmalonic aciduria type B protein |
Gene ID | 326625 |
mRNA Refseq | NM_052845 |
Protein Refseq | NP_443077 |
MIM | 607568 |
UniProt ID | Q96EY8 |
Chromosome Location | 12q24 |
Pathway | Cobalamin (Cbl, vitamin B12) transport and metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem |
Function | ATP binding; cob(I)yrinic acid a,c-diamide adenosyltransferase activity; cob(I)yrinic acid a,c-diamide adenosyltransferase activity |
◆ Recombinant Proteins | ||
MMAB-574H | Recombinant Human MMAB Protein, MYC/DDK-tagged | +Inquiry |
MMAB-27647TH | Recombinant Human MMAB, His-tagged | +Inquiry |
MMAB-559HF | Recombinant Full Length Human MMAB Protein, GST-tagged | +Inquiry |
MMAB-5592M | Recombinant Mouse MMAB Protein, His (Fc)-Avi-tagged | +Inquiry |
MMAB-3185H | Recombinant Human MMAB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMAB-4285HCL | Recombinant Human MMAB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMAB Products
Required fields are marked with *
My Review for All MMAB Products
Required fields are marked with *