Recombinant Human MMAB, GST-tagged

• Cat.No.: MMAB-629H
• Product Overview: Recombinant Human MMAB(1 a.a. - 250 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-250 a.a.
• Description: This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 53.8 kDa
• AA Sequence: MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGER RPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPI LELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLAR YAAMKEGNQEKIYMKNDPSAESEGL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: MMAB methylmalonic aciduria (cobalamin deficiency) cblB type [ Homo sapiens ]
• Official Symbol: MMAB
• Synonyms: ATR; cob; cblB; CFAP23; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial; ATP:cob(I)alamin adenosyltransferase; ATP:corrinoid adenosyltransferase; aquocob(I)alamin vitamin B12s adenosyltransferase; cilia and flagella associated protein 23; methylmalonic aciduria type B protein
• Gene ID: 326625
• mRNA Refseq: NM_052845
• Protein Refseq: NP_443077
• MIM: 607568
• UniProt ID: Q96EY8
• Chromosome Location: 12q24
• Pathway: Cobalamin (Cbl, vitamin B12) transport and metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: ATP binding; cob(I)yrinic acid a,c-diamide adenosyltransferase activity; cob(I)yrinic acid a,c-diamide adenosyltransferase activity