"NAA20" Related Products

Recombinant Human NAA20 protein, T7-tagged

Cat.No.: NAA20-171H
Product Overview: Recombinant human NAA20 (178 aa, Isoform-A) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGK AEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVI EYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro NatB mediated cell cycle regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NAA20 protein-protein interaction.4. Potential diagnostic biomarker for cancer.5. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: NAA20 N(alpha)-acetyltransferase 20, NatB catalytic subunit [ Homo sapiens ]
Official Symbol: NAA20
Synonyms: NAA20; N(alpha)-acetyltransferase 20, NatB catalytic subunit; N acetyltransferase 5 , N acetyltransferase 5 (ARD1 homolog, S. cerevisiae) , N acetyltransferase 5 (GCN5 related, putative) , N acetyltransferase 5, ARD1 subunit (arrest defective 1, S. cerevisiae, homolog) , NAT5; N-alpha-acetyltransferase 20; dJ1002M8.1; N acetyltransferase 3 homolog (S. cerevisiae); NAT3; natB catalytic subunit; natB complex subunit NAT5; N-acetyltransferase 3 homolog; N-acetyltransferase 5 (GCN5-related, putative); N-terminal acetyltransferase complex ARD1 subunit; N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae); N-alpha-acetyltransferase 20, NatB catalytic subunit; N-terminal acetyltransferase B complex catalytic subunit NAT5; N-terminal acetyltransferase B complex catalytic subunit NAA20; N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog); NAT5;
Gene ID: 51126
mRNA Refseq: NM_016100
Protein Refseq: NP_057184
MIM: 610833
UniProt ID: P61599
Chromosome Location: 20p11.23
Function: N-acetyltransferase activity; peptide alpha-N-acetyltransferase activity; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.