Recombinant Human NAA20 protein, T7-tagged
Cat.No. : | NAA20-171H |
Product Overview : | Recombinant human NAA20 (178 aa, Isoform-A) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 178 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGK AEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVI EYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro NatB mediated cell cycle regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NAA20 protein-protein interaction.4. Potential diagnostic biomarker for cancer.5. May be used as antigen for specific antibody development. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NAA20 N(alpha)-acetyltransferase 20, NatB catalytic subunit [ Homo sapiens ] |
Official Symbol | NAA20 |
Synonyms | NAA20; N(alpha)-acetyltransferase 20, NatB catalytic subunit; N acetyltransferase 5 , N acetyltransferase 5 (ARD1 homolog, S. cerevisiae) , N acetyltransferase 5 (GCN5 related, putative) , N acetyltransferase 5, ARD1 subunit (arrest defective 1, S. cerevisiae, homolog) , NAT5; N-alpha-acetyltransferase 20; dJ1002M8.1; N acetyltransferase 3 homolog (S. cerevisiae); NAT3; natB catalytic subunit; natB complex subunit NAT5; N-acetyltransferase 3 homolog; N-acetyltransferase 5 (GCN5-related, putative); N-terminal acetyltransferase complex ARD1 subunit; N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae); N-alpha-acetyltransferase 20, NatB catalytic subunit; N-terminal acetyltransferase B complex catalytic subunit NAT5; N-terminal acetyltransferase B complex catalytic subunit NAA20; N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog); NAT5; |
Gene ID | 51126 |
mRNA Refseq | NM_016100 |
Protein Refseq | NP_057184 |
MIM | 610833 |
UniProt ID | P61599 |
Chromosome Location | 20p11.23 |
Function | N-acetyltransferase activity; peptide alpha-N-acetyltransferase activity; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
NAA20-171H | Recombinant Human NAA20 protein, T7-tagged | +Inquiry |
NAA20-465C | Recombinant Cynomolgus Monkey NAA20 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAA20-2255Z | Recombinant Zebrafish NAA20 | +Inquiry |
NAT5-1194H | Recombinant Human NAT5, His-tagged | +Inquiry |
Nat5-1818R | Recombinant Rat Nat5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAA20-3993HCL | Recombinant Human NAA20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAA20 Products
Required fields are marked with *
My Review for All NAA20 Products
Required fields are marked with *