Recombinant Human NAGK protein, T7-tagged

Cat.No. : NAGK-146H
Product Overview : Recombinant human NAGK (19 - 419aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 19-419 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMRTRTGSQLAAREVTGSGAVPRQLEGRRCQAGRDANGGTSSDGSSSMAAIYGGVEGGGTR SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIE ELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAV KIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAG EMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALG GASLGARHIGHLLPMDYSANAIAFYSYTFS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro NAGK mediated protein glycosylation modification study with this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NAGK protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name NAGK N-acetylglucosamine kinase [ Homo sapiens ]
Official Symbol NAGK
Synonyms NAGK; N-acetylglucosamine kinase; N-acetyl-D-glucosamine kinase; GNK; glcNAc kinase; HSA242910;
Gene ID 55577
mRNA Refseq NM_017567
Protein Refseq NP_060037
MIM 606828
UniProt ID Q9UJ70
Chromosome Location 2p24.3-p24.1
Pathway Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; N-acetylglucosamine degradation II, organism-specific biosystem;
Function ATP binding; N-acetylglucosamine kinase activity; N-acylmannosamine kinase activity; kinase activity; nucleotide binding; protein binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAGK Products

Required fields are marked with *

My Review for All NAGK Products

Required fields are marked with *

0
cart-icon
0
compare icon