Recombinant Human NCBP2 protein, GST-tagged

Cat.No. : NCBP2-3266H
Product Overview : Recombinant Human NCBP2 protein(P52298)(1-156aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-156aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.9 kDa
AA Sequence : SGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NCBP2 nuclear cap binding protein subunit 2, 20kDa [ Homo sapiens ]
Official Symbol NCBP2
Synonyms NCBP2; nuclear cap binding protein subunit 2, 20kDa; nuclear cap binding protein subunit 2, 20kD; nuclear cap-binding protein subunit 2; Cbc2; CBP20; NIP1; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; 20 kDa nuclear cap-binding protein; cell proliferation-inducing gene 55 protein; CBC2; PIG55;
Gene ID 22916
mRNA Refseq NM_001042540
Protein Refseq NP_001036005
MIM 605133
UniProt ID P52298

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCBP2 Products

Required fields are marked with *

My Review for All NCBP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon