Recombinant Human NCBP2 protein, GST-tagged
Cat.No. : | NCBP2-3266H |
Product Overview : | Recombinant Human NCBP2 protein(P52298)(1-156aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-156aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | SGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NCBP2 nuclear cap binding protein subunit 2, 20kDa [ Homo sapiens ] |
Official Symbol | NCBP2 |
Synonyms | NCBP2; nuclear cap binding protein subunit 2, 20kDa; nuclear cap binding protein subunit 2, 20kD; nuclear cap-binding protein subunit 2; Cbc2; CBP20; NIP1; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; 20 kDa nuclear cap-binding protein; cell proliferation-inducing gene 55 protein; CBC2; PIG55; |
Gene ID | 22916 |
mRNA Refseq | NM_001042540 |
Protein Refseq | NP_001036005 |
MIM | 605133 |
UniProt ID | P52298 |
◆ Recombinant Proteins | ||
Ncbp2-4305M | Recombinant Mouse Ncbp2 Protein, Myc/DDK-tagged | +Inquiry |
NCBP2-468H | Recombinant Human NCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NCBP2-3266H | Recombinant Human NCBP2 protein, GST-tagged | +Inquiry |
NCBP2-4848C | Recombinant Chicken NCBP2 | +Inquiry |
NCBP2-29865TH | Recombinant Human NCBP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCBP2-3952HCL | Recombinant Human NCBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCBP2 Products
Required fields are marked with *
My Review for All NCBP2 Products
Required fields are marked with *
0
Inquiry Basket