Recombinant Human ND4L protein, GST-tagged
| Cat.No. : | ND4L-301385H |
| Product Overview : | Recombinant Human ND4L (1-98 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Cys98 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | MT-ND4L mitochondrially encoded NADH 4L dehydrogenase [ Homo sapiens (human) ] |
| Official Symbol | ND4L |
| Synonyms | MTND4L; MT-ND4L |
| Gene ID | 4539 |
| Protein Refseq | YP_003024034 |
| MIM | 516004 |
| UniProt ID | 7GXZ4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ND4L Products
Required fields are marked with *
My Review for All ND4L Products
Required fields are marked with *
