Recombinant Human NRD1 protein, GST-tagged

Cat.No. : NRD1-186H
Product Overview : Recombinant Human NRD1(1058 a.a. - 1156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1058-1156 a.a.
Description : This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : VVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS KSDLVNWFKAHRGPGSKMLSVHVV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name NRD1 nardilysin (N-arginine dibasic convertase) [ Homo sapiens ]
Official Symbol NRD1
Synonyms NRD1; nardilysin (N-arginine dibasic convertase); nardilysin; hNRD1; hNRD2; NRD-C; NRD convertase;
Gene ID 4898
mRNA Refseq NM_002525
Protein Refseq NP_002516
MIM 602651
UniProt ID O43847
Chromosome Location 1p32.2-p32.1
Function epidermal growth factor binding; metal ion binding; metalloendopeptidase activity; peptidase activity; protein binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRD1 Products

Required fields are marked with *

My Review for All NRD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon