Recombinant Human NRD1 protein, GST-tagged
Cat.No. : | NRD1-186H |
Product Overview : | Recombinant Human NRD1(1058 a.a. - 1156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1058-1156 a.a. |
Description : | This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS KSDLVNWFKAHRGPGSKMLSVHVV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NRD1 nardilysin (N-arginine dibasic convertase) [ Homo sapiens ] |
Official Symbol | NRD1 |
Synonyms | NRD1; nardilysin (N-arginine dibasic convertase); nardilysin; hNRD1; hNRD2; NRD-C; NRD convertase; |
Gene ID | 4898 |
mRNA Refseq | NM_002525 |
Protein Refseq | NP_002516 |
MIM | 602651 |
UniProt ID | O43847 |
Chromosome Location | 1p32.2-p32.1 |
Function | epidermal growth factor binding; metal ion binding; metalloendopeptidase activity; peptidase activity; protein binding; zinc ion binding; |
◆ Recombinant Proteins | ||
NRD1-4078R | Recombinant Rat NRD1 Protein | +Inquiry |
NRD1-2509H | Recombinant Human NRD1 Protein, His-tagged | +Inquiry |
NRD1-186H | Recombinant Human NRD1 protein, GST-tagged | +Inquiry |
Nrd1-1859M | Recombinant Mouse Nrd1 Protein, His-tagged | +Inquiry |
NRD1-9019HFL | Recombinant Full Length Human NRD1 protein, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRD1 Products
Required fields are marked with *
My Review for All NRD1 Products
Required fields are marked with *