Recombinant Human NRD1 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Human NRD1 protein, GST-tagged

Recombinant Human NRD1 protein, GST-tagged

NRD1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : NRD1-186H
Product Overview : Recombinant Human NRD1(1058 a.a. - 1156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : VVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS KSDLVNWFKAHRGPGSKMLSVHVV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : NRD1 nardilysin (N-arginine dibasic convertase) [ Homo sapiens ]
Official Symbol : NRD1
Synonyms : NRD1; nardilysin (N-arginine dibasic convertase); nardilysin; hNRD1; hNRD2; NRD-C; NRD convertase;
Gene ID : 4898
mRNA Refseq : NM_002525
Protein Refseq : NP_002516
MIM : 602651
UniProt ID : O43847
Chromosome Location : 1p32.2-p32.1
Function : epidermal growth factor binding; metal ion binding; metalloendopeptidase activity; peptidase activity; protein binding; zinc ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.