"NRD1" Related Products

Recombinant Human NRD1 protein, GST-tagged

Cat.No.: NRD1-186H
Product Overview: Recombinant Human NRD1(1058 a.a. - 1156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: VVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS KSDLVNWFKAHRGPGSKMLSVHVV
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: NRD1 nardilysin (N-arginine dibasic convertase) [ Homo sapiens ]
Official Symbol: NRD1
Synonyms: NRD1; nardilysin (N-arginine dibasic convertase); nardilysin; hNRD1; hNRD2; NRD-C; NRD convertase;
Gene ID: 4898
mRNA Refseq: NM_002525
Protein Refseq: NP_002516
MIM: 602651
UniProt ID: O43847
Chromosome Location: 1p32.2-p32.1
Function: epidermal growth factor binding; metal ion binding; metalloendopeptidase activity; peptidase activity; protein binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.