Recombinant Human PLA2G2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PLA2G2A-3541H
Product Overview : PLA2G2A MS Standard C13 and N15-labeled recombinant protein (NP_000291) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.
Molecular Mass : 16.1 kDa
AA Sequence : MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PLA2G2A phospholipase A2 group IIA [ Homo sapiens (human) ]
Official Symbol PLA2G2A
Synonyms PLA2G2A; phospholipase A2, group IIA (platelets, synovial fluid); PLA2B, PLA2L; phospholipase A2, membrane associated; NPS-PLA2; GIIC sPLA2; group IIA phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; non-pancreatic secretory phospholipase A2; MOM1; PLA2; PLA2B; PLA2L; PLA2S; PLAS1; sPLA2;
Gene ID 5320
mRNA Refseq NM_000300
Protein Refseq NP_000291
MIM 172411
UniProt ID P14555

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G2A Products

Required fields are marked with *

My Review for All PLA2G2A Products

Required fields are marked with *

0
cart-icon