Recombinant Human PMM2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PMM2-6090H
Product Overview : PMM2 MS Standard C13 and N15-labeled recombinant protein (NP_000294) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I.
Molecular Mass : 27.9 kDa
AA Sequence : MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PMM2 phosphomannomutase 2 [ Homo sapiens (human) ]
Official Symbol PMM2
Synonyms PMM2; phosphomannomutase 2; CDG1; CDG1a; CDGS; PMM 2;
Gene ID 5373
mRNA Refseq NM_000303
Protein Refseq NP_000294
MIM 601785
UniProt ID O15305

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PMM2 Products

Required fields are marked with *

My Review for All PMM2 Products

Required fields are marked with *

0
cart-icon
0
compare icon