Recombinant Human PRDM2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PRDM2-5535H
Product Overview : PRDM2 MS Standard C13 and N15-labeled recombinant protein (NP_001129082) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 25.3 kDa
AA Sequence : MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKSRHSGCSLTAPEVTWNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PRDM2 PR/SET domain 2 [ Homo sapiens (human) ]
Official Symbol PRDM2
Synonyms PRDM2; PR domain containing 2, with ZNF domain; PR domain zinc finger protein 2; GATA 3 binding protein G3B; HUMHOXY1; KMT8; MTB ZF; MTE binding protein; retinoblastoma protein binding zinc finger protein; retinoblastoma protein interacting zinc finger protein; RIZ; RIZ1; RIZ2; zinc finger DNA binding protein; MTE-binding protein; zinc finger protein RIZ; GATA-3 binding protein G3B; GATA-3-binding protein G3B; lysine N-methyltransferase 8; PR domain-containing protein 2; zinc-finger DNA-binding protein; retinoblastoma protein-binding zinc finger protein; retinoblastoma protein-interacting zinc finger protein; MTB-ZF;
Gene ID 7799
mRNA Refseq NM_001135610
Protein Refseq NP_001129082
MIM 601196
UniProt ID Q13029

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDM2 Products

Required fields are marked with *

My Review for All PRDM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon