Recombinant Human PRDM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PRDM2-5535H |
| Product Overview : | PRDM2 MS Standard C13 and N15-labeled recombinant protein (NP_001129082) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 25.3 kDa |
| AA Sequence : | MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKSRHSGCSLTAPEVTWNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PRDM2 PR/SET domain 2 [ Homo sapiens (human) ] |
| Official Symbol | PRDM2 |
| Synonyms | PRDM2; PR domain containing 2, with ZNF domain; PR domain zinc finger protein 2; GATA 3 binding protein G3B; HUMHOXY1; KMT8; MTB ZF; MTE binding protein; retinoblastoma protein binding zinc finger protein; retinoblastoma protein interacting zinc finger protein; RIZ; RIZ1; RIZ2; zinc finger DNA binding protein; MTE-binding protein; zinc finger protein RIZ; GATA-3 binding protein G3B; GATA-3-binding protein G3B; lysine N-methyltransferase 8; PR domain-containing protein 2; zinc-finger DNA-binding protein; retinoblastoma protein-binding zinc finger protein; retinoblastoma protein-interacting zinc finger protein; MTB-ZF; |
| Gene ID | 7799 |
| mRNA Refseq | NM_001135610 |
| Protein Refseq | NP_001129082 |
| MIM | 601196 |
| UniProt ID | Q13029 |
| ◆ Recombinant Proteins | ||
| Prdm2-475M | Recombinant Mouse Prdm2 Protein, MYC/DDK-tagged | +Inquiry |
| PRDM2-27746TH | Recombinant Human PRDM2 | +Inquiry |
| PRDM2-4314R | Recombinant Rat PRDM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRDM2-4655R | Recombinant Rat PRDM2 Protein | +Inquiry |
| PRDM2-3342H | Recombinant Human PRDM2 protein(Met1-Ala200), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDM2 Products
Required fields are marked with *
My Review for All PRDM2 Products
Required fields are marked with *
