Recombinant Human PRM2 protein(11-80 aa), C-His-tagged
Cat.No. : | PRM2-2545H |
Product Overview : | Recombinant Human PRM2 protein(P04554)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-80 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRR |
◆ Recombinant Proteins | ||
PRM2-717H | Recombinant Human PRM2 Protein, His/GST-tagged | +Inquiry |
PRM2-7122M | Recombinant Mouse PRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23187SF | Recombinant Full Length Saccharomyces Cerevisiae Pheromone-Regulated Membrane Protein 3(Prm2) Protein, His-Tagged | +Inquiry |
PRM2-13413M | Recombinant Mouse PRM2 Protein | +Inquiry |
PRM2-2545H | Recombinant Human PRM2 protein(11-80 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRM2-2841HCL | Recombinant Human PRM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRM2 Products
Required fields are marked with *
My Review for All PRM2 Products
Required fields are marked with *