Recombinant Human RAB12 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB12-5912H |
Product Overview : | RAB12 MS Standard C13 and N15-labeled recombinant protein (NP_001020471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RAB12 (RAB12, Member RAS Oncogene Family) is a Protein Coding gene. Among its related pathways are RAB GEFs exchange GTP for GDP on RABs and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RAB3C. |
Molecular Mass : | 27.1 kDa |
AA Sequence : | MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB12 RAB12, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB12 |
Synonyms | RAB12; RAB12, member RAS oncogene family; ras-related protein Rab-12; putative Ras-related protein Rab-12 |
Gene ID | 201475 |
mRNA Refseq | NM_001025300 |
Protein Refseq | NP_001020471 |
MIM | 616448 |
UniProt ID | Q6IQ22 |
◆ Recombinant Proteins | ||
RAB12-5912H | Recombinant Human RAB12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RAB12-803HFL | Recombinant Full Length Human RAB12 Protein, C-Flag-tagged | +Inquiry |
RAB12-4533R | Recombinant Rat RAB12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB12-7340M | Recombinant Mouse RAB12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB12-5744H | Recombinant Human RAB12 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB12 Products
Required fields are marked with *
My Review for All RAB12 Products
Required fields are marked with *
0
Inquiry Basket