Recombinant Human RAB12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RAB12-5912H
Product Overview : RAB12 MS Standard C13 and N15-labeled recombinant protein (NP_001020471) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RAB12 (RAB12, Member RAS Oncogene Family) is a Protein Coding gene. Among its related pathways are RAB GEFs exchange GTP for GDP on RABs and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RAB3C.
Molecular Mass : 27.1 kDa
AA Sequence : MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RAB12 RAB12, member RAS oncogene family [ Homo sapiens (human) ]
Official Symbol RAB12
Synonyms RAB12; RAB12, member RAS oncogene family; ras-related protein Rab-12; putative Ras-related protein Rab-12
Gene ID 201475
mRNA Refseq NM_001025300
Protein Refseq NP_001020471
MIM 616448
UniProt ID Q6IQ22

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAB12 Products

Required fields are marked with *

My Review for All RAB12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon