Recombinant Human RAB24 protein, T7/His-tagged
Cat.No. : | RAB24-166H |
Product Overview : | Recombinant human Rab24 cDNA ( 202 aa, derived from BC015534 ) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVA KVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKS DLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYF YSCCHH |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | RAB24 RAB24, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB24 |
Synonyms | RAB24; RAB24, member RAS oncogene family; ras-related protein Rab-24; |
Gene ID | 53917 |
mRNA Refseq | NM_001031677 |
Protein Refseq | NP_001026847 |
MIM | 612415 |
UniProt ID | Q969Q5 |
Chromosome Location | 5q35.3 |
Function | GTP binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RAB24-166H | Recombinant Human RAB24 protein, T7/His-tagged | +Inquiry |
RAB24-31280TH | Recombinant Human RAB24, His-tagged | +Inquiry |
Rab24-1104M | Active Recombinant Mouse RAB24, member RAS oncogene family, GST-tagged | +Inquiry |
RAB24-13799M | Recombinant Mouse RAB24 Protein | +Inquiry |
RAB24-5085C | Recombinant Chicken RAB24 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB24-2617HCL | Recombinant Human RAB24 293 Cell Lysate | +Inquiry |
RAB24-2616HCL | Recombinant Human RAB24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB24 Products
Required fields are marked with *
My Review for All RAB24 Products
Required fields are marked with *
0
Inquiry Basket