Recombinant Human RAB24 protein, T7/His-tagged
| Cat.No. : | RAB24-166H |
| Product Overview : | Recombinant human Rab24 cDNA ( 202 aa, derived from BC015534 ) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVA KVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKS DLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYF YSCCHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | RAB24 RAB24, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB24 |
| Synonyms | RAB24; RAB24, member RAS oncogene family; ras-related protein Rab-24; |
| Gene ID | 53917 |
| mRNA Refseq | NM_001031677 |
| Protein Refseq | NP_001026847 |
| MIM | 612415 |
| UniProt ID | Q969Q5 |
| Chromosome Location | 5q35.3 |
| Function | GTP binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| RAB24-2108H | Recombinant Human RAB24, GST-tagged | +Inquiry |
| RAB24-812H | Recombinant Human RAB24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RAB24-3197Z | Recombinant Zebrafish RAB24 | +Inquiry |
| RAB24-13799M | Recombinant Mouse RAB24 Protein | +Inquiry |
| RAB24-7347M | Recombinant Mouse RAB24 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB24-2617HCL | Recombinant Human RAB24 293 Cell Lysate | +Inquiry |
| RAB24-2616HCL | Recombinant Human RAB24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB24 Products
Required fields are marked with *
My Review for All RAB24 Products
Required fields are marked with *
