Recombinant Human RBFOX2 protein, GST-tagged

• Cat.No.: RBFOX2-209H
• Product Overview: Recombinant Human RBFOX2(1 a.a. - 450 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-450 a.a.
• Description: This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 73.6 kDa
• AA Sequence: MAEGAQPQQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGMQNEPLTPGYHGFPA RDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQN GSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFV TFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAAFSFQADVSLG NDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDG FYGADLYGGYAACRYAQPATATAATAAAAAAAAYGDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RBFOX2 RNA binding protein, fox-1 homolog (C. elegans) 2 [ Homo sapiens ]
• Official Symbol: RBFOX2
• Synonyms: RBFOX2; RNA binding protein, fox-1 homolog (C. elegans) 2; RBM9, RNA binding motif protein 9; RNA binding protein fox-1 homolog 2; FOX 2; hexaribonucleotide binding protein 2; HNRBP2; HRNBP2; fox-1 homolog B; fox-1 homologue; RNA-binding motif protein 9; hexaribonucleotide-binding protein 2; repressor of tamoxifen transcriptional activity; RTA; fxh; FOX2; RBM9; Fox-2; dJ106I20.3
• Gene ID: 23543
• mRNA Refseq: NM_014309
• Protein Refseq: NP_055124
• MIM: 612149
• UniProt ID: O43251
• Chromosome Location: 22q12-q13
• Function: RNA binding; nucleotide binding; protein binding; transcription corepressor activity; transcription factor binding