Recombinant Human RBFOX3 protein, GST-tagged
Cat.No. : | RBFOX3-1268H |
Product Overview : | Recombinant Human RBFOX3 protein(1-100 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-100 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR |
Gene Name | RBFOX3 RNA binding protein, fox-1 homolog (C. elegans) 3 [ Homo sapiens ] |
Official Symbol | RBFOX3 |
Synonyms | RBFOX3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein fox-1 homolog 3; FOX 3; hexaribonucleotide binding protein 3; HRNBP3; NeuN; neuronal nuclei; fox-1 homolog C; FOX3; NEUN; FOX-3; FLJ56884; FLJ58356; |
Gene ID | 146713 |
mRNA Refseq | NM_001082575 |
Protein Refseq | NP_001076044 |
UniProt ID | A6NFN3 |
◆ Recombinant Proteins | ||
RBFOX3-1268H | Recombinant Human RBFOX3 protein, GST-tagged | +Inquiry |
RBFOX3-1267H | Recombinant Human RBFOX3, His-tagged | +Inquiry |
RBFOX3-1269H | Recombinant Human RBFOX3 protein, GST & His-tagged | +Inquiry |
RBFOX3-3970H | Recombinant Human RBFOX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBFOX3-5679H | Recombinant Human RBFOX3 Protein (Met1-Arg100), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBFOX3 Products
Required fields are marked with *
My Review for All RBFOX3 Products
Required fields are marked with *
0
Inquiry Basket