Recombinant Human RRM1
| Cat.No. : | RRM1-29473TH |
| Product Overview : | Recombinant fragment of Human RRM1 (amino acids 644-753) with N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTV WEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSM HFYGWKQGLKTGMYYLRTRPAANPIQFTLN |
| Sequence Similarities : | Belongs to the ribonucleoside diphosphate reductase large chain family.Contains 1 ATP-cone domain. |
| Gene Name | RRM1 ribonucleotide reductase M1 [ Homo sapiens ] |
| Official Symbol | RRM1 |
| Synonyms | RRM1; ribonucleotide reductase M1; ribonucleotide reductase M1 polypeptide; ribonucleoside-diphosphate reductase large subunit; |
| Gene ID | 6240 |
| mRNA Refseq | NM_001033 |
| Protein Refseq | NP_001024 |
| MIM | 180410 |
| Uniprot ID | P23921 |
| Chromosome Location | 11p15.5 |
| Pathway | E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | ATP binding; oxidoreductase activity; purine nucleotide binding; ribonucleoside-diphosphate reductase activity; ribonucleoside-diphosphate reductase activity; |
| ◆ Recombinant Proteins | ||
| RRM1-9023Z | Recombinant Zebrafish RRM1 | +Inquiry |
| RRM1-374H | Recombinant Human RRM1 Protein, His-tagged | +Inquiry |
| RRM1-785H | Recombinant Human RRM1 Protein (1-792 aa), His-SUMO-tagged | +Inquiry |
| RRM1-6205H | Recombinant Human RRM1 Protein (Met1-Pro213), His tagged | +Inquiry |
| RRM1-1921H | Recombinant Human RRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RRM1-291HKCL | Human RRM1 Knockdown Cell Lysate | +Inquiry |
| RRM1-001HCL | Recombinant Human RRM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRM1 Products
Required fields are marked with *
My Review for All RRM1 Products
Required fields are marked with *
