Recombinant Human RRM1
Cat.No. : | RRM1-29473TH |
Product Overview : | Recombinant fragment of Human RRM1 (amino acids 644-753) with N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTV WEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSM HFYGWKQGLKTGMYYLRTRPAANPIQFTLN |
Sequence Similarities : | Belongs to the ribonucleoside diphosphate reductase large chain family.Contains 1 ATP-cone domain. |
Gene Name | RRM1 ribonucleotide reductase M1 [ Homo sapiens ] |
Official Symbol | RRM1 |
Synonyms | RRM1; ribonucleotide reductase M1; ribonucleotide reductase M1 polypeptide; ribonucleoside-diphosphate reductase large subunit; |
Gene ID | 6240 |
mRNA Refseq | NM_001033 |
Protein Refseq | NP_001024 |
MIM | 180410 |
Uniprot ID | P23921 |
Chromosome Location | 11p15.5 |
Pathway | E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; oxidoreductase activity; purine nucleotide binding; ribonucleoside-diphosphate reductase activity; ribonucleoside-diphosphate reductase activity; |
◆ Recombinant Proteins | ||
RRM1-785H | Recombinant Human RRM1 Protein (1-792 aa), His-SUMO-tagged | +Inquiry |
RRM1-8650H | Recombinant Human RRM1, His-GST tagged | +Inquiry |
RRM1-374H | Recombinant Human RRM1 Protein, His-tagged | +Inquiry |
RRM1-179HFL | Active Recombinant Full Length Human RRM1 Protein, C-Flag-tagged | +Inquiry |
RRM1-3853R | Recombinant Rhesus Macaque RRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRM1-001HCL | Recombinant Human RRM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRM1 Products
Required fields are marked with *
My Review for All RRM1 Products
Required fields are marked with *
0
Inquiry Basket