Recombinant Human RRP7A protein, His-tagged
Cat.No. : | RRP7A-2912H |
Product Overview : | Recombinant Human RRP7A protein(1-176 aa), fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-176 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RRP7A ribosomal RNA processing 7 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RRP7A |
Synonyms | RRP7A; ribosomal RNA processing 7 homolog A (S. cerevisiae); ribosomal RNA-processing protein 7 homolog A; CGI 96; CTA-126B4.5; gastric cancer antigen Zg14; CGI-96; BK126B4.3; MGC150422; MGC150423; |
Gene ID | 27341 |
mRNA Refseq | NM_015703 |
Protein Refseq | NP_056518 |
UniProt ID | Q9Y3A4 |
◆ Recombinant Proteins | ||
RRP7A-4039R | Recombinant Rhesus monkey RRP7A Protein, His-tagged | +Inquiry |
RRP7A-2357Z | Recombinant Zebrafish RRP7A | +Inquiry |
RRP7A-4786C | Recombinant Chicken RRP7A | +Inquiry |
RRP7A-2912H | Recombinant Human RRP7A protein, His-tagged | +Inquiry |
RRP7A-7820M | Recombinant Mouse RRP7A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRP7A-2141HCL | Recombinant Human RRP7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRP7A Products
Required fields are marked with *
My Review for All RRP7A Products
Required fields are marked with *