Recombinant Human SAR1A protein, T7-tagged

Cat.No. : SAR1A-123H
Product Overview : Recombinant human SAR1a (198 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 198 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNK IDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro receptor membrane trafficking regulation study with recombinant SAR1a protein intracellular delivery methods.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days.
Gene Name SAR1A SAR1 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol SAR1A
Synonyms SAR1A; SAR1 homolog A (S. cerevisiae); SARA1; masra2;
Gene ID 56681
mRNA Refseq NM_001142648
Protein Refseq NP_001136120
MIM 607691
UniProt ID Q9NR31
Chromosome Location 10q22.1
Pathway COPII complex, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem;
Function GTP binding; GTPase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAR1A Products

Required fields are marked with *

My Review for All SAR1A Products

Required fields are marked with *

0
cart-icon