Recombinant Human SAR1A protein, T7-tagged

• Cat.No.: SAR1A-123H
• Product Overview: Recombinant human SAR1a (198 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 198 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNK IDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro receptor membrane trafficking regulation study with recombinant SAR1a protein intracellular delivery methods.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days.

Gene Information

• Gene Name: SAR1A SAR1 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SAR1A
• Synonyms: SAR1A; SAR1 homolog A (S. cerevisiae); SARA1; masra2
• Gene ID: 56681
• mRNA Refseq: NM_001142648
• Protein Refseq: NP_001136120
• MIM: 607691
• UniProt ID: Q9NR31
• Chromosome Location: 10q22.1
• Pathway: COPII complex, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem
• Function: GTP binding; GTPase activity; nucleotide binding