"SAR1A" Related Products

Recombinant Human SAR1A protein, T7-tagged

Cat.No.: SAR1A-123H
Product Overview: Recombinant human SAR1a (198 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNK IDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro receptor membrane trafficking regulation study with recombinant SAR1a protein intracellular delivery methods.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days.
Gene Name: SAR1A SAR1 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol: SAR1A
Synonyms: SAR1A; SAR1 homolog A (S. cerevisiae); SARA1; masra2;
Gene ID: 56681
mRNA Refseq: NM_001142648
Protein Refseq: NP_001136120
MIM: 607691
UniProt ID: Q9NR31
Chromosome Location: 10q22.1
Pathway: COPII complex, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem;
Function: GTP binding; GTPase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.