Recombinant Human SCFD1 protein, His-tagged
Cat.No. : | SCFD1-019H |
Product Overview : | Recombinant Human SCFD1 protein(NP_001244305)(342-642 aa), fused to His tag, was expressed in E. coli. |
Availability | July 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 342-642 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | QQELESYRAQEDEVKRLKSIMGLEGEDEGAISMLSDNTAKLTSAVSSLPELLEKKRLIDLHTNVATAVLEHIKARKLDVYFEYEEKIMSKTTLDKSLLDIISDPDAGTPEDKMRLFLIYYISTQQAPSEADLEQYKKALTDAGCNLNPLQYIKQWKAFTKMASAPASYGSTTTKPMGLLSRVMNTGSQFVMEGVKNLVLKQQNLPVTRILDNLMEMKSNPETDDYRYFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGKHILYGCSELFNATQFIKQLSQLGQK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | SCFD1 sec1 family domain containing 1 [ Homo sapiens ] |
Official Symbol | SCFD1 |
Synonyms | SCFD1; sec1 family domain containing 1; C14orf163, chromosome 14 open reading frame 163; sec1 family domain-containing protein 1; KIAA0917; RA410; SLY1; STXBP1L2; SLY1 homolog; syntaxin-binding protein 1-like 2; vesicle transport-related protein; SLY1P; C14orf163; |
Gene ID | 23256 |
mRNA Refseq | NM_001257376 |
Protein Refseq | NP_001244305 |
UniProt ID | Q8WVM8 |
◆ Recombinant Proteins | ||
SCFD1-7929M | Recombinant Mouse SCFD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCFD1-3158H | Recombinant Human SCFD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCFD1-019H | Recombinant Human SCFD1 protein, His-tagged | +Inquiry |
Scfd1-5706M | Recombinant Mouse Scfd1 Protein, Myc/DDK-tagged | +Inquiry |
SCFD1-4470C | Recombinant Chicken SCFD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCFD1-2041HCL | Recombinant Human SCFD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCFD1 Products
Required fields are marked with *
My Review for All SCFD1 Products
Required fields are marked with *