Recombinant Human SCFD1 protein, His-tagged

Cat.No. : SCFD1-019H
Product Overview : Recombinant Human SCFD1 protein(NP_001244305)(342-642 aa), fused to His tag, was expressed in E. coli.
Availability July 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 342-642 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : QQELESYRAQEDEVKRLKSIMGLEGEDEGAISMLSDNTAKLTSAVSSLPELLEKKRLIDLHTNVATAVLEHIKARKLDVYFEYEEKIMSKTTLDKSLLDIISDPDAGTPEDKMRLFLIYYISTQQAPSEADLEQYKKALTDAGCNLNPLQYIKQWKAFTKMASAPASYGSTTTKPMGLLSRVMNTGSQFVMEGVKNLVLKQQNLPVTRILDNLMEMKSNPETDDYRYFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGKHILYGCSELFNATQFIKQLSQLGQK
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name SCFD1 sec1 family domain containing 1 [ Homo sapiens ]
Official Symbol SCFD1
Synonyms SCFD1; sec1 family domain containing 1; C14orf163, chromosome 14 open reading frame 163; sec1 family domain-containing protein 1; KIAA0917; RA410; SLY1; STXBP1L2; SLY1 homolog; syntaxin-binding protein 1-like 2; vesicle transport-related protein; SLY1P; C14orf163;
Gene ID 23256
mRNA Refseq NM_001257376
Protein Refseq NP_001244305
UniProt ID Q8WVM8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCFD1 Products

Required fields are marked with *

My Review for All SCFD1 Products

Required fields are marked with *

0
cart-icon