Recombinant Human SCUBE3 protein, His&Myc-tagged
Cat.No. : | SCUBE3-3244H |
Product Overview : | Recombinant Human SCUBE3 protein(Q8IX30)(804-916aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 804-916a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTY |
Gene Name | SCUBE3 signal peptide, CUB domain, EGF-like 3 [ Homo sapiens ] |
Official Symbol | SCUBE3 |
Synonyms | SCUBE3; signal peptide, CUB domain, EGF-like 3; CEGF3, CUB domain and EGF like repeat containing 3; signal peptide, CUB and EGF-like domain-containing protein 3; FLJ34743; CUB and EGF containing protein 3; CUB domain and EGF-like repeat containing 3; signal peptide, CUB and EGF-like domain containing protein 3; CEGF3; DKFZp686B1223; DKFZp686B09105; DKFZp686D20108; |
Gene ID | 222663 |
mRNA Refseq | NM_152753 |
Protein Refseq | NP_689966 |
UniProt ID | Q8IX30 |
◆ Recombinant Proteins | ||
SCUBE3-14784M | Recombinant Mouse SCUBE3 Protein | +Inquiry |
SCUBE3-7953M | Recombinant Mouse SCUBE3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCUBE3-66H | Active Recombinant Human SCUBE3 Protein, HA-tagged | +Inquiry |
SCUBE3-1546H | Recombinant Human SCUBE3 protein, His & T7-tagged | +Inquiry |
SCUBE3-5755H | Recombinant Human SCUBE3 Protein (Glu807-Lys993), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCUBE3 Products
Required fields are marked with *
My Review for All SCUBE3 Products
Required fields are marked with *