Recombinant Human SGTB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SGTB-3496H |
Product Overview : | SGTB MS Standard C13 and N15-labeled recombinant protein (NP_061945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSAEEHSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SGTB small glutamine rich tetratricopeptide repeat containing beta [ Homo sapiens (human) ] |
Official Symbol | SGTB |
Synonyms | SGTB; small glutamine rich tetratricopeptide repeat containing beta; SGT2; small glutamine-rich tetratricopeptide repeat-containing protein beta; beta-SGT; small glutamine rich protein with tetratricopeptide repeats 2; small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta |
Gene ID | 54557 |
mRNA Refseq | NM_019072 |
Protein Refseq | NP_061945 |
UniProt ID | Q96EQ0 |
◆ Recombinant Proteins | ||
SGTB-15050M | Recombinant Mouse SGTB Protein | +Inquiry |
SGTB-5029R | Recombinant Rat SGTB Protein, His (Fc)-Avi-tagged | +Inquiry |
Sgtb-5831M | Recombinant Mouse Sgtb Protein, Myc/DDK-tagged | +Inquiry |
SGTB-2086HFL | Recombinant Full Length Human SGTB Protein, C-Flag-tagged | +Inquiry |
SGTB-5370R | Recombinant Rat SGTB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGTB-1881HCL | Recombinant Human SGTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGTB Products
Required fields are marked with *
My Review for All SGTB Products
Required fields are marked with *