Recombinant Human SGTB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SGTB-3496H
Product Overview : SGTB MS Standard C13 and N15-labeled recombinant protein (NP_061945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.
Molecular Mass : 33.4 kDa
AA Sequence : MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSAEEHSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SGTB small glutamine rich tetratricopeptide repeat containing beta [ Homo sapiens (human) ]
Official Symbol SGTB
Synonyms SGTB; small glutamine rich tetratricopeptide repeat containing beta; SGT2; small glutamine-rich tetratricopeptide repeat-containing protein beta; beta-SGT; small glutamine rich protein with tetratricopeptide repeats 2; small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
Gene ID 54557
mRNA Refseq NM_019072
Protein Refseq NP_061945
UniProt ID Q96EQ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SGTB Products

Required fields are marked with *

My Review for All SGTB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon