Recombinant Human SGTB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SGTB-3496H
• Product Overview: SGTB MS Standard C13 and N15-labeled recombinant protein (NP_061945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.
• Molecular Mass: 33.4 kDa
• AA Sequence: MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSAEEHSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SGTB small glutamine rich tetratricopeptide repeat containing beta [ Homo sapiens (human) ]
• Official Symbol: SGTB
• Synonyms: SGTB; small glutamine rich tetratricopeptide repeat containing beta; SGT2; small glutamine-rich tetratricopeptide repeat-containing protein beta; beta-SGT; small glutamine rich protein with tetratricopeptide repeats 2; small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
• Gene ID: 54557
• mRNA Refseq: NM_019072
• Protein Refseq: NP_061945
• UniProt ID: Q96EQ0