Recombinant Human SKAP2, His-tagged
| Cat.No. : | SKAP2-190H |
| Product Overview : | Recombinant Human Src Kinase-Associated Phosphoprotein 2/SKAP2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ile359) of Human SKAP2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-359 a.a. |
| Description : | Src Kinase-Associated Phosphoprotein 2 (SKAP2) is a member of the SKAP family. SKAP2 is a cytoplasmic protein and contains one PH domain and one SH3 domain. SKAP2 acts as an adaptor that is thought to play an improtant role in the Src signaling pathway in various cells. SKAP2 may be involved in B-cell and macrophage adhesion processes. In B-cells, it may function by coupling B-cell receptor to activate integrin. |
| AA Sequence : | MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQD KGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDH SFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKR IYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEI YEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIY ILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDIVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | SKAP2 src kinase associated phosphoprotein 2 [ Homo sapiens ] |
| Official Symbol | SKAP2 |
| Synonyms | SKAP2; src kinase associated phosphoprotein 2; SCAP2, src family associated phosphoprotein 2; src kinase-associated phosphoprotein 2; RA70; SAPS; SKAP HOM; SKAP55R; SKAP-55HOM; SKAP55 homolog; Pyk2/RAFTK-associated protein; src-associated adaptor protein; retinoic acid-induced protein 70; src family associated phosphoprotein 2; src family-associated phosphoprotein 2; Fyn-associated phosphoprotein SKAP55 homologue; src-associated adapter protein with PH and SH3 domains; src kinase-associated phosphoprotein 55-related protein; src kinase-associated phosphoprotein of 55-related protein; PRAP; SCAP2; SKAP-HOM; MGC10411; MGC33304; |
| Gene ID | 8935 |
| mRNA Refseq | NM_003930 |
| Protein Refseq | NP_003921 |
| MIM | 605215 |
| UniProt ID | O75563 |
| Chromosome Location | 7p15.2 |
| Pathway | Cell-Cell communication, organism-specific biosystem; Signal regulatory protein (SIRP) family interactions, organism-specific biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem; |
| Function | SH3/SH2 adaptor activity; |
| ◆ Recombinant Proteins | ||
| Skap2-5894M | Recombinant Mouse Skap2 Protein, Myc/DDK-tagged | +Inquiry |
| SKAP2-10901Z | Recombinant Zebrafish SKAP2 | +Inquiry |
| SKAP2-2686H | Recombinant Human SKAP2, GST-tagged | +Inquiry |
| SKAP2-4030R | Recombinant Rhesus Macaque SKAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SKAP2-15171M | Recombinant Mouse SKAP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SKAP2-1816HCL | Recombinant Human SKAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKAP2 Products
Required fields are marked with *
My Review for All SKAP2 Products
Required fields are marked with *
