Recombinant Human SLC25A19 Full Length Transmembrane protein, His-tagged
Cat.No. : | SLC25A19-1006H |
Product Overview : | Recombinant Human SLC25A19 protein(Q9HC21)(1-320aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-320aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.0 kDa |
AA Sequence : | MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | SLC25A19 solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [ Homo sapiens ] |
Official Symbol | SLC25A19 |
Synonyms | SLC25A19; solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19; MCPHA, microcephaly, Amish , solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; mitochondrial thiamine pyrophosphate carrier; DNC; MUP1; TPC; microcephaly, Amish; mitochondrial uncoupling protein 1; solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; MCPHA; THMD3; THMD4; |
Gene ID | 60386 |
mRNA Refseq | NM_001126121 |
Protein Refseq | NP_001119593 |
MIM | 606521 |
UniProt ID | Q9HC21 |
◆ Recombinant Proteins | ||
SLC25A19-8275M | Recombinant Mouse SLC25A19 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A19-11735Z | Recombinant Zebrafish SLC25A19 | +Inquiry |
RFL34168BF | Recombinant Full Length Bovine Mitochondrial Thiamine Pyrophosphate Carrier(Slc25A19) Protein, His-Tagged | +Inquiry |
RFL6968HF | Recombinant Full Length Human Mitochondrial Thiamine Pyrophosphate Carrier(Slc25A19) Protein, His-Tagged | +Inquiry |
SLC25A19-2719H | Recombinant Human SLC25A19, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC25A19 Products
Required fields are marked with *
My Review for All SLC25A19 Products
Required fields are marked with *
0
Inquiry Basket