Recombinant Human SLC25A19 Full Length Transmembrane protein, His-tagged

• Cat.No.: SLC25A19-1006H
• Product Overview: Recombinant Human SLC25A19 protein(Q9HC21)(1-320aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-320aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.0 kDa
• AA Sequence: MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SLC25A19 solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [ Homo sapiens ]
• Official Symbol: SLC25A19
• Synonyms: SLC25A19; solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19; MCPHA, microcephaly, Amish , solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; mitochondrial thiamine pyrophosphate carrier; DNC; MUP1; TPC; microcephaly, Amish; mitochondrial uncoupling protein 1; solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19; MCPHA; THMD3; THMD4
• Gene ID: 60386
• mRNA Refseq: NM_001126121
• Protein Refseq: NP_001119593
• MIM: 606521
• UniProt ID: Q9HC21