Recombinant Human SLC25A30 Protein (1-291 aa), His-SUMO-tagged

• Cat.No.: SLC25A30-1037H
• Product Overview: Recombinant Human SLC25A30 Protein (1-291 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transport. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-291 aa
• Description: Probable transporter.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 48.5 kDa
• AA Sequence: MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: SLC25A30 solute carrier family 25, member 30 [ Homo sapiens ]
• Official Symbol: SLC25A30
• Synonyms: KMCP1
• Gene ID: 253512
• mRNA Refseq: NM_001010875.2
• Protein Refseq: NP_001010875.1
• MIM: 610793
• UniProt ID: Q5SVS4