Recombinant Human SMCP Protein, GST-tagged

• Cat.No.: SMCP-4509H
• Product Overview: Human MCSP full-length ORF ( AAH14593, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperms mitochondrial sheath. [provided by RefSeq
• Molecular Mass: 38.50 kDa
• AA Sequence: MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SMCP sperm mitochondria-associated cysteine-rich protein [ Homo sapiens ]
• Official Symbol: SMCP
• Synonyms: SMCP; sperm mitochondria-associated cysteine-rich protein; MCSP, mitochondrial capsule selenoprotein; sperm mitochondrial-associated cysteine-rich protein; mitochondrial capsule selenoprotein; MCS; MCSP; HSMCSGEN1; MGC26305; MGC26519
• Gene ID: 4184
• mRNA Refseq: NM_030663
• Protein Refseq: NP_109588
• MIM: 601148
• UniProt ID: P49901