Recombinant Human SMCP Protein, GST-tagged
Cat.No. : | SMCP-4509H |
Product Overview : | Human MCSP full-length ORF ( AAH14593, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperms mitochondrial sheath. [provided by RefSeq |
Molecular Mass : | 38.50 kDa |
AA Sequence : | MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SMCP sperm mitochondria-associated cysteine-rich protein [ Homo sapiens ] |
Official Symbol | SMCP |
Synonyms | SMCP; sperm mitochondria-associated cysteine-rich protein; MCSP, mitochondrial capsule selenoprotein; sperm mitochondrial-associated cysteine-rich protein; mitochondrial capsule selenoprotein; MCS; MCSP; HSMCSGEN1; MGC26305; MGC26519; |
Gene ID | 4184 |
mRNA Refseq | NM_030663 |
Protein Refseq | NP_109588 |
MIM | 601148 |
UniProt ID | P49901 |
◆ Recombinant Proteins | ||
SMCP-2083H | Recombinant Human SMCP Protein, His&GST-tagged | +Inquiry |
SMCP-8474M | Recombinant Mouse SMCP Protein, His (Fc)-Avi-tagged | +Inquiry |
SMCP-946C | Recombinant Cynomolgus SMCP Protein, His-tagged | +Inquiry |
SMCP-4342R | Recombinant Rhesus monkey SMCP Protein, His-tagged | +Inquiry |
SMCP-5617R | Recombinant Rat SMCP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMCP-1664HCL | Recombinant Human SMCP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMCP Products
Required fields are marked with *
My Review for All SMCP Products
Required fields are marked with *
0
Inquiry Basket