Recombinant Human SP3 protein, GST-tagged
Cat.No. : | SP3-903H |
Product Overview : | Recombinant Human SP3(1 a.a. - 781 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-781 a.a. |
Description : | This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. A related pseudogene has been identified on chromosome 13. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 112.4 kDa |
AA Sequence : | MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLALLAATCSKIGPPSPG DDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIKDEAGNLVQIPSAATSSGQYVLPLQNLQNQQ IFSVAPGSDSSNGTVSSVQYQVIPQIQSADGQQVQIGFTGSSDNGGINQESSQIQIIPGSNQTLLASGTPSANIQ NLIPQTGQVQVQGVAIGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLSGSSQTMTAGINADGHLINTG QAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQS PVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLI QAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVT VNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVAC TCPNCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTH TGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGT VNTSATSNQDILTNTEIPLQLVTVSGNETME |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SP3 Sp3 transcription factor [ Homo sapiens ] |
Official Symbol | SP3 |
Synonyms | SP3; Sp3 transcription factor; transcription factor Sp3; SPR 2; specificity protein 3; GC-binding transcription factor Sp3; SPR2; DKFZp686O1631; |
Gene ID | 6670 |
mRNA Refseq | NM_001017371 |
Protein Refseq | NP_001017371 |
MIM | 601804 |
UniProt ID | Q02447 |
Chromosome Location | 2q31 |
Pathway | Regulation of Telomerase, organism-specific biosystem; Selenium Metabolism and Selenoproteins, organism-specific biosystem; |
Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; chromatin binding; core promoter proximal region sequence-specific DNA binding; double-stranded DNA binding; metal ion binding; protein binding; zinc ion binding; |
◆ Recombinant Proteins | ||
SP3-2094H | Active Recombinant Human Sp3 Transcription Factor, FLAG-tagged | +Inquiry |
SP3-15794M | Recombinant Mouse SP3 Protein | +Inquiry |
SP3-8597M | Recombinant Mouse SP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SP3-4733HFL | Recombinant Full Length Human SP3, Flag-tagged | +Inquiry |
SP3-301162H | Recombinant Human SP3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SP3 Products
Required fields are marked with *
My Review for All SP3 Products
Required fields are marked with *
0
Inquiry Basket