Recombinant Human SPAG16 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPAG16-1615H
Product Overview : SPAG16 MS Standard C13 and N15-labeled recombinant protein (NP_001020607) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively.
Molecular Mass : 20.4 kDa
AA Sequence : MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPAG16 sperm associated antigen 16 [ Homo sapiens (human) ]
Official Symbol SPAG16
Synonyms SPAG16; sperm associated antigen 16; sperm-associated antigen 16 protein; DKFZp666P1710; FLJ22724; PF20; WDR29; WD repeat domain 29; pf20 protein homolog; sperm-associated WD repeat protein; FLJ37717; MGC87036;
Gene ID 79582
mRNA Refseq NM_001025436
Protein Refseq NP_001020607
MIM 612173
UniProt ID Q8N0X2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPAG16 Products

Required fields are marked with *

My Review for All SPAG16 Products

Required fields are marked with *

0
cart-icon
0
compare icon