Recombinant Human SPAG16 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPAG16-1615H |
Product Overview : | SPAG16 MS Standard C13 and N15-labeled recombinant protein (NP_001020607) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPAG16 sperm associated antigen 16 [ Homo sapiens (human) ] |
Official Symbol | SPAG16 |
Synonyms | SPAG16; sperm associated antigen 16; sperm-associated antigen 16 protein; DKFZp666P1710; FLJ22724; PF20; WDR29; WD repeat domain 29; pf20 protein homolog; sperm-associated WD repeat protein; FLJ37717; MGC87036; |
Gene ID | 79582 |
mRNA Refseq | NM_001025436 |
Protein Refseq | NP_001020607 |
MIM | 612173 |
UniProt ID | Q8N0X2 |
◆ Recombinant Proteins | ||
SPAG16-1615H | Recombinant Human SPAG16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPAG16-704C | Recombinant Cynomolgus Monkey SPAG16 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spag16-6069M | Recombinant Mouse Spag16 Protein, Myc/DDK-tagged | +Inquiry |
SPAG16-961C | Recombinant Cynomolgus SPAG16 Protein, His-tagged | +Inquiry |
SPAG16-989H | Recombinant Human SPAG16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAG16 Products
Required fields are marked with *
My Review for All SPAG16 Products
Required fields are marked with *
0
Inquiry Basket