Recombinant Human SSU72 protein, His-tagged

• Cat.No.: SSU72-2973H
• Product Overview: Recombinant Human SSU72 protein(14-194 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 14-194 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: SNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SSU72 SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SSU72
• Synonyms: SSU72; SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae); Ssu72 RNA polymerase II CTD phosphatase homolog (yeast); RNA polymerase II subunit A C-terminal domain phosphatase SSU72; HSPC182; CTD phosphatase SSU72; PNAS-120; FLJ13048
• Gene ID: 29101
• mRNA Refseq: NM_014188
• Protein Refseq: NP_054907
• UniProt ID: Q9NP77