Recombinant Human SSU72 protein, His-tagged

Cat.No. : SSU72-2973H
Product Overview : Recombinant Human SSU72 protein(14-194 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability August 22, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 14-194 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : SNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name SSU72 SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol SSU72
Synonyms SSU72; SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae); Ssu72 RNA polymerase II CTD phosphatase homolog (yeast); RNA polymerase II subunit A C-terminal domain phosphatase SSU72; HSPC182; CTD phosphatase SSU72; PNAS-120; FLJ13048;
Gene ID 29101
mRNA Refseq NM_014188
Protein Refseq NP_054907
UniProt ID Q9NP77

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSU72 Products

Required fields are marked with *

My Review for All SSU72 Products

Required fields are marked with *

0
cart-icon
0
compare icon