Recombinant Human SYT4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYT4-5222H |
Product Overview : | SYT4 MS Standard C13 and N15-labeled recombinant protein (NP_065834) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Plays a role in dendrite formation by melanocytes. |
Molecular Mass : | 48 kDa |
AA Sequence : | MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWHVLCDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYT4 synaptotagmin IV [ Homo sapiens (human) ] |
Official Symbol | SYT4 |
Synonyms | SYT4; synaptotagmin IV; synaptotagmin-4; HsT1192; KIAA1342; sytIV; synaptotagmin 4; |
Gene ID | 6860 |
mRNA Refseq | NM_020783 |
Protein Refseq | NP_065834 |
MIM | 600103 |
UniProt ID | Q9H2B2 |
◆ Recombinant Proteins | ||
SYT4-4407R | Recombinant Rhesus Macaque SYT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2111MF | Recombinant Full Length Mouse Synaptotagmin-4(Syt4) Protein, His-Tagged | +Inquiry |
SYT4-8928M | Recombinant Mouse SYT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYT4-16336M | Recombinant Mouse SYT4 Protein | +Inquiry |
SYT4-7538H | Recombinant Human SYT4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYT4-1304HCL | Recombinant Human SYT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYT4 Products
Required fields are marked with *
My Review for All SYT4 Products
Required fields are marked with *