Recombinant Human TMA7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMA7-1585H |
Product Overview : | CCDC72 MS Standard C13 and N15-labeled recombinant protein (NP_057017) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TMA7 (Translation Machinery Associated 7 Homolog) is a Protein Coding gene. An important paralog of this gene is ENSG00000225528. |
Molecular Mass : | 7.1 kDa |
AA Sequence : | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMA7 translation machinery associated 7 homolog [ Homo sapiens (human) ] |
Official Symbol | TMA7 |
Synonyms | CCDC72; HSPC016; translation machinery-associated protein 7; coiled-coil domain containing 72; coiled-coil domain-containing protein 72; translational machinery associated 7 homolog; TMA7 |
Gene ID | 51372 |
mRNA Refseq | NM_015933 |
Protein Refseq | NP_057017 |
MIM | 615808 |
UniProt ID | Q9Y2S6 |
◆ Recombinant Proteins | ||
TMA7-12H | Recombinant Human TMA7 protein, MYC/DDK-tagged | +Inquiry |
TMA7-1585H | Recombinant Human TMA7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMA7-1391H | Recombinant Human TMA7 | +Inquiry |
Tma7-6459M | Recombinant Mouse Tma7 Protein, Myc/DDK-tagged | +Inquiry |
TMA7-7439Z | Recombinant Zebrafish TMA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMA7-7750HCL | Recombinant Human CCDC72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMA7 Products
Required fields are marked with *
My Review for All TMA7 Products
Required fields are marked with *