Recombinant Human TMED9 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMED9-604H |
Product Overview : | TMED9 MS Standard C13 and N15-labeled recombinant protein (NP_059980) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. |
Molecular Mass : | 27.3 kDa |
AA Sequence : | MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMED9 transmembrane emp24 protein transport domain containing 9 [ Homo sapiens (human) ] |
Official Symbol | TMED9 |
Synonyms | TMED9; transmembrane p24 trafficking protein 9; p25; GMP25; p24a2; HSGP25L2G; p24alpha2; transmembrane emp24 domain-containing protein 9; glycoprotein 25L2; p24 family protein alpha-2; transmembrane emp24 protein transport domain containing 9 |
Gene ID | 54732 |
mRNA Refseq | NM_017510 |
Protein Refseq | NP_059980 |
UniProt ID | Q9BVK6 |
◆ Recombinant Proteins | ||
TMED9-4570R | Recombinant Rhesus Macaque TMED9 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMED9-1208H | Recombinant Human TMED9 Protein (40-197 aa), GST-tagged | +Inquiry |
TMED9-5760R | Recombinant Rat TMED9 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMED9-6103R | Recombinant Rat TMED9 Protein | +Inquiry |
Tmed9-6464M | Recombinant Mouse Tmed9 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMED9-1021HCL | Recombinant Human TMED9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMED9 Products
Required fields are marked with *
My Review for All TMED9 Products
Required fields are marked with *