Recombinant Human TMED9 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMED9-604H
• Product Overview: TMED9 MS Standard C13 and N15-labeled recombinant protein (NP_059980) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster.
• Molecular Mass: 27.3 kDa
• AA Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMED9 transmembrane emp24 protein transport domain containing 9 [ Homo sapiens (human) ]
• Official Symbol: TMED9
• Synonyms: TMED9; transmembrane p24 trafficking protein 9; p25; GMP25; p24a2; HSGP25L2G; p24alpha2; transmembrane emp24 domain-containing protein 9; glycoprotein 25L2; p24 family protein alpha-2; transmembrane emp24 protein transport domain containing 9
• Gene ID: 54732
• mRNA Refseq: NM_017510
• Protein Refseq: NP_059980
• UniProt ID: Q9BVK6